Maintenance Technician II

4 weeks ago


Capitol Heights, Maryland, United States Virginia Linen Service Inc Full time

h3JobDescription/h3pWeareseekingaskilledbMaintenanceTechnicianII/btojoinourteamatVirginiaLinenServiceofMaryland,Inc./ppThisisachallengingroleinahighlyautomatedenvironmentwhereyoucanmakearealdifference.AsanIndustrialMaintenanceSpecialist,youwillberesponsibleforrepairing,maintaining,troubleshooting,andinstallingvariousequipmentandcomponentsofourautomatedprocessingfacility./ppTheidealcandidatewillhaveknowledgeofseveralareas,including:/pulliPreventativemaintenanceprocedures/liliBoilers/liliAircompressors/liliWeldingandPiping/liliHydraulicsandpneumatics/liliElectricalcircuitryandPLC's/liliElectro/mechanicalutilityandelectricaltroubleshooting/liliGeneralequipmentandbuildingmaintenance/li/ulpExperiencewithaircylinders,solenoidvalves,steamtraps,motorstarters,gearreducers,inverterdrives,orindustriallaundryequipmentisaplus./ppTheresponsibilitiesofthisroleinclude:/pulliPerformingwell-definedpreventativemaintenanceprograms/liliCommunicatingandworkingwithalllevelsofmanagementandsupportingexistingengineeringteamsorassistinginotherareasand/ordepartmentsasneeded/liliMaintainingsafetyandcleanlinessstandards/liliTroubleshootingsourcesofequipmentproblemsbyobservingmechanical,electrical,pneumatic,andhydraulicsystemsequipmentandcomponentdevicesinoperation/liliUsingprecisionmeasuringandtestinginstruments/liliAssistingothermaintenancepersonnelwithemergencyandnon-emergencyrepairs/liliInspectingmotorsandbelts,checkingfluidlevels,replacingfilters,andperformingothermaintenanceactionswhilefollowingmaintenanceprocedures/liliPerformingvariousweldingactivities,includingMIG,TIG,ARC,cutting,andbrazing/liliTroubleshootingandrepairingProgrammableLogicControllers(PLC's)andassociatedcontrolsystems/liliPerformingboilerchemicaltesting/liliPerformingdailyandweeklysafetychecksonboilersandmakingnecessaryrepairs/liliPerformingwastewaterpretreatmentsystemtesting/liliCleaningandlubricatingshafts,bearings,gears,andotherpartsoflocationequipmentperworkproceduresortechnicalmanual/li/ulpQualificationsinclude:/pulliAbilitytoreadandunderstandmaintenanceliteratureprintedinEnglish/liliHighschooldiploma/GED/liliGeneralknowledgeandskillsrepresentingagoodmechanicalbackground/liliAbilitytoworkaflexibleschedule/liliAbilitytolift,push,andpullupto50pounds/liliBasiccomputerskills/liliAbilitytostandforupto7hoursofan8-hourshift/liliMaintenanceknowledge-sufficientformalorinformaltrainingtoperformthedutiesofthisposition/liliAnycombinationofgeneralmaintenance,buildingmaintenance,equipmentmaintenance,automotivemaintenance,construction,plumbing,electrical,andmilitaryexperienceisacceptable/liliExperiencewithformalizedsafetyprograms,suchasLockOut/TagOut,confinedspace,OSHAawareness,TechnicalSchoolCoursesorLadderSafety,ispreferred/liliMinimumofatleast2yearsofsuccessfulmaintenanceexperience/li/ulpBenefitsinclude:/pulliGroupbenefitspackage(Medical,Dental,Short-termDisability,Vision,LifeInsurance,and401kwithgenerouscompanymatch)/liliPaidVacation/li/ulpVirginiaLinenServiceofMaryland,Inc.isalinenrentalsupplyandcommerciallaundrycompanydedicatedtoresourceconservationandsocialresponsibility.Weprovidelinen,textile,andhygieneservicestothehospitality,firstclasslodging,healthcare,andsmallbusinesscustomers.WeareanEqualOpportunityEmployerthatrecruitsandhiresqualifiedcandidateswithoutregardtorace,religion,sex,sexualorientation,genderidentity,age,nationalorigin,ancestry,citizenship,disability,orveteranstatus.



  • Capitol Heights, Maryland, United States Virginia Linen Service Inc Full time

    Job DescriptionVirginia Linen Service of Maryland, Inc. is seeking a skilled Maintenance Technician II Stationary Engineer to join our team. As a key member of our maintenance team, you will be responsible for ensuring the smooth operation of our automated processing facility.Key Responsibilities:Perform preventative maintenance procedures to ensure...


  • Capitol Heights, Maryland, United States Republic Services Full time

    Job SummaryThe Maintenance Lead Technician is a critical role within the Republic Services team, responsible for overseeing the maintenance and repair of heavy-duty trucks and refuse bodywork. This position requires a high level of technical expertise, leadership skills, and attention to detail.Key ResponsibilitiesProvide direction and guidance to...


  • Capitol Heights, Maryland, United States Republic Services Full time

    About the CompanyRepublic Services, Inc. is a leading provider of environmental services, serving customers across North America. Our commitment to sustainability and customer satisfaction drives our business, and we're dedicated to creating a more circular and decarbonized world.Job SummaryThe Fleet Maintenance Supervisor is responsible for overseeing the...


  • Capitol Heights, Maryland, United States McDonald's Full time

    About the JobWe are seeking a skilled Maintenance Person to join our team at McDonald's. As a key member of our maintenance team, you will be responsible for ensuring the cleanliness and maintenance of our restaurant's interior and exterior, as well as maintaining our equipment.ResponsibilitiesFilter oil fryers daily to maintain a clean and safe...


  • Capitol Heights, Maryland, United States Virginia Linen Service Inc Full time

    Job SummaryWe are seeking a highly skilled and experienced Plant Maintenance Engineer to join our team at Virginia Linen Service of Maryland, Inc. As a key member of our maintenance team, you will be responsible for overseeing the maintenance and repair of our industrial equipment and facilities.Key ResponsibilitiesLead and manage a team of maintenance...

  • Support Technician

    1 month ago


    Capitol Heights, Maryland, United States Dave & Buster Full time

    Job Title: Support TechnicianAbout the Role:At Dave & Buster's, we're looking for a Support Technician to join our team. As a Support Technician, you will be responsible for the repair and maintenance of our building's games, simulators, and technical equipment. You will also assist our Guests and maintain ideal player conditions in the midway at all...


  • Capitol Heights, Maryland, United States Dave & Busters Full time

    Senior Games TechnicianAt Dave & Busters, we're committed to delivering an exceptional Guest experience through the best combination of food, drinks, and games. As a Senior Games Technician, you'll play a critical role in ensuring our games are always up and running, providing timely and accurate service to our Guests.Key Responsibilities:Deliver an...

  • Diesel Technician

    4 weeks ago


    Capitol Heights, Maryland, United States Republic Services Full time

    Key Responsibilities:Maintain a solid understanding of vehicle systems to perform routine maintenance and repairs. Ensure the upkeep of diesel and non-diesel equipment and trucks. Work under the guidance of a Lead Technician, Maintenance Supervisor, or Maintenance Manager. Develop skills in basic electrical work, such as light changes, and tire changes....


  • Capitol Heights, Maryland, United States Penske Truck Leasing Full time

    Job Summary:A Refrigeration Technician at Penske will diagnose, overhaul, adjust, and repair all series of motor truck and trailer equipment with a focus on commercial refrigeration unit maintenance equipment.Main Responsibilities:Perform all levels of maintenance services, with a focus on refrigeration unit maintenance, such as Carrier and/or Thermo King...


  • Capitol Heights, Maryland, United States ServiceSource Full time

    Job SummaryThis position requires familiarity with office terminology and procedures. The General Clerk II selects appropriate methods from a wide variety of procedures or makes simple adaptations and interpretations of a limited number of substantive guides and manuals.Primary DutiesTransfer mail tubs from loading docks to mail room in the morning and...


  • Linthicum Heights, Maryland, United States Bowlero Full time

    Bowling Equipment SpecialistAt Bowlero, we're looking for a skilled Maintenance Technician to join our team. As a key member of our maintenance team, you'll be responsible for ensuring the smooth operation of our bowling equipment. Your duties will include: Maintaining all bowling equipment to ensure optimal performance Ensuring the shop and machine area are...


  • Capitol Heights, Maryland, United States Holistic Industries Full time

    Job DescriptionAbout the Job:The purpose of this role is to assist the Lab Supervisor and Technicians with the maintenance of general lab functions, production, and overall organization in a licensed cannabis facility.Responsibilities:Coordinate daily lab tasks with the Laboratory SupervisorPrepare plant material for extraction, including grinding and...

  • Diesel Mechanic

    1 month ago


    Capitol Heights, Maryland, United States Penske Truck Leasing Full time

    Job Title: Diesel Technician/MechanicJob Summary:A Penske Refrigeration Technician will diagnose, overhaul, adjust, and repair all series of motor truck and trailer equipment with a primary focus on refrigeration unit maintenance equipment designed for commercial trucks and trailers.Key Responsibilities:Perform all levels of maintenance services, with a...

  • HVAC Technician

    1 month ago


    Capitol Heights, Maryland, United States Johnson Controls Full time

    Job SummaryJohnson Controls is seeking a skilled HVAC Truck Based Mechanic to join their team. As a key member of the maintenance team, you will be responsible for performing routine maintenance, repairs, and replacements on commercial heating and cooling systems.Key ResponsibilitiesPerform maintenance, repair, and replacement services on commercial heating...

  • HVAC Technician

    1 month ago


    Capitol Heights, Maryland, United States Johnson Controls Full time

    Job Title: HVAC Truck Based Chiller MechanicAt Johnson Controls, we are seeking a skilled HVAC Truck Based Chiller Mechanic to join our team. As a key member of our maintenance team, you will be responsible for executing contract maintenance visits, inspections, site assessments, and service requests. You will also be expected to provide quote estimates for...


  • Hillcrest Heights, Maryland, United States Forman Mills Full time

    Job Summary:As a Maintenance Technician at Forman Mills, you will be responsible for maintaining the cleanliness and organization of the store. This includes ensuring proper stocking and replenishment of merchandise, monitoring and managing inventory levels, and coordinating the receiving and processing of shipments. Additionally, you will conduct regular...


  • Capitol Heights, Maryland, United States Buffalo Wild Wings Full time

    Cleanliness and Sanitation TechnicianAt Buffalo Wild Wings, we're looking for a Cleanliness and Sanitation Technician to join our team. As a key member of our facilities maintenance team, you'll be responsible for maintaining a clean and safe environment for our guests and staff. Your duties will include managing the daily cleaning of the sports bar,...


  • Capitol Heights, Maryland, United States Republic Services Full time

    Job SummaryAs a Maintenance Technician B at Republic Services, you will be responsible for performing repair and maintenance work on diesel and non-diesel equipment and trucks. This includes, but is not limited to, chassis components, vehicle refuse bodies and control systems, hydraulic electrical, air brake systems, general engine work, HVAC components,...


  • Capitol Heights, Maryland, United States Penske Truck Leasing Full time

    Job DescriptionLocation: 9210 E Hampton Dr. Capitol Heights, MD, 20743What's the Job?Ready to accelerate your career while helping our customers move forward? As a Customer Service Representative Fueler/Washer at Penske, you'll do exactly that. You will make sure vehicles are fueled, clean and safe before they hit the road again. You will be the face of...

  • General Clerk II

    4 weeks ago


    Capitol Heights, Maryland, United States ServiceSource Full time

    Job SummaryThis position requires familiarity with office terminology and procedures. The General Clerk selects appropriate methods from a wide variety of procedures or makes simple adaptations and interpretations of a limited number of substantive guides and manuals. The clerical steps often vary in type or sequence, depending on the task. Recognized...