Business Analyst

2 weeks ago


Minnesota Lake, United States CareerBuilder Full time

Business Analyst (Banking or Digital Payments experience)Location:

Prefer Hybrid (1 day a week in MN office)

OverviewWe are doing green field development to deliver cutting age payment technologies across multiple industries. Delivering this value requires a complex collection of services, but can be generalized as React user interfaces, interfacing with Spring Boot APIs, Functional Execution / Lambda, Events / Pub Sub, NoSQL / Dynamo, API Gateway / Apigee with the primary deployment model being IAC / CICD on public cloud infrastructure such as AWS. Certain capabilities and extensions of capabilities reside in legacy data centers in order to interact with core banking services.

The above technologies and capabilities enable ChoicePay, a Business to Consumer digital payments platform that simplifies the process of delivering funds to the end consumer for both the payer and the payee.

This area of focus is one of the most important new initiatives, and provides an opportunity to engage with cutting edge technologies while delivering innovative new solutions for our customers.

We are looking for highly motivated, intelligent, technologists with high engagement and a track record of lifelong learning.

We cover end to end solution development, from the user interface all the way through to all of the back end services and security integrations. We create entire cloud based environments with fully configured and deployed application stacks via IAC, CICD and DevOps. We have fully embraced the Product model, are Agile and conduct our development in adherence to the best practices of SCRUM.

Experience with as many of these services as possible is highly desired:

Core Tech Stack

Banking experiencecloudChoicePay or any other Business to Consumer digital payments platform

Technology Overview

Elastic Container Service / Fargate / EC2LambdaTransfer FamilyS3Security HubRDSSecrets ManagerSystems ManagerQuickSightEC2Quantum Ledger DatabaseAmplifiyCodeBuildBackupSNSConfigCloudWatchCode ArtifactCloud FrontCode CommitService CatalogVPCGuardDutyData Transfer/Data SyncLoad balancingSESStep FunctionsX-RayECSCognitoDynamoDBECRGlueCloudWatch EventsAPI GatewayRoute 53AppSyncGlacierCost ExplorerWAFCloud TrailCode PipelineKMSWorkMailSQSFirehoseAdditional Technologies

AcmApigatewayBackupBatchCloudformationCloudfrontCloudtrailCloudwatchCodeartifactcognito-idpconfigdynamodbec2ecrecseventsfirehoseiamkmslambdalogsqldbrdss3secretsmanagerservicequotassessnssqsssmststransferwafv2#DICEmtroje@c4techservices.com
#J-18808-Ljbffr


  • Business Analyst

    7 days ago


    Minneapolis, Minnesota, United States Novon Consulting Full time

    BA will work on various business and system conversion activities for client. BA Description Responsible for helping the business transform their vision for our Financial Professionals [Financial Advisors] into working products using Agile methodologies and tools to build roadmaps, create stories, and work with IT on refinement, sprint planning, and...


  • Minnesota City, United States CareerBuilder Full time

    Dice is the leading career destination for tech experts at every stage of their careers. Our client, Ledelsea, is seeking the following. Apply via Dice today! Qualifications: 3-5+ years implementing and configuring core Financial related systems on SAP. Specifically, AP, AR, and Tax and associated financial and management reporting Subject matter knowledge...

  • Business Analyst

    2 weeks ago


    Lake Mary, United States Tata Consultancy Services Full time

    Skill: Business Analyst 8+ years relevant experience in Business Analysis. Work on Requirement Elicitation, Documentation and communication, using Agile methodologies, Business Process Modelling, Data Analysis, Stakeholder management, Quality assurance and change management, Analytical thinking, domain knowledge, problem solving, Negotiation and conflict...


  • Lake Forest, United States Precise Solutions Full time

    Job DescriptionJob DescriptionAt Precise Solutions, we are looking for top talent consultants to bring on as employees of our organization and service our clients in the various Life Sciences Industries.  We are much more than a consulting firm! Precise Solutions provides competitive compensation packages with great salaries, benefits, health insurance,...


  • Lake Oswego, United States Yakima Products Full time

    At Yakima we believe in connecting you, your family, friends and all your favorite gear to your desired destination or activity through our mission of enhancing the journey and earning trust every day. The Jr. IT Business Analyst will provide project management and requirement gathering related to the ERP systems and upgrades, application and interface...

  • Business Analyst

    5 days ago


    Minneapolis, Minnesota, United States SPS COMMERCE Full time

    Description: The Community Business Analyst will be a supporting member of the Program Management team. The position’s primary responsibilities consist of working with internal and external data sets to optimize the information in a way that best sets our teams up for success and cross collaborating to mine data and perform ad-hoc analytics to spot...

  • Business Analyst

    7 hours ago


    Lake Mary, United States Diverse Lynx Full time

    Role: Business Analyst Location: Lake Mary FL (Onsite) Duration: Full-time JD: Role Description: • 8+ years relevant experience in Business Analysis. • Work on Requirement Elicitation, Documentation and communication, using Agile methodologies, Business Process Modelling, Data Analysis, Stakeholder management, Quality assurance and change...


  • Lake Mary, United States Verinext Full time

    Join Verinext, a technology company thats not just keeping up with the future, but actively shaping it. At Verinext, we firmly believe that work should be as enjoyable as it is rewarding. As a Sr. Business Analyst, you'll be stepping into an environment that thrives on innovation and fun. Our team-oriented culture isnt just a buzzword; its a cornerstone of...


  • Salt Lake, Utah, United States bioMerieux SA Career Site - MULTI-LINGUAL Full time

    Description Position Summary:Business Analyst Interns partner with software teams to research, plan, test, and maintain critical solutions for various software applications. This will require you to provide high quality customer service to internal parties and develop strong relationships with partners inside the business. You will support technical teams...


  • Elk River, Minnesota, United States Cretex Companies, Inc. Full time

    Overview: The Epicor ERP Business Analyst Developer plays a critical role in bridging the gap between business needs and technical solutions within an organization. This position combines the responsibilities of a business analyst, who identifies and defines business requirements, with those of a developer, who designs and implements software solutions to...

  • Business Analyst

    9 hours ago


    West Lake Hills, United States JobRialto Full time

    Location: Westlake TX, Durham NC, OR Merrimack NH Description As a Business Analyst, you will join a team of passionate Health & Welfare professionals committed to crafting business requirements that are crucial to our ability to serve as a directed record keeper for our plan sponsors. You will serve as requirements expert and are responsible for providing...


  • Minnesota City, United States Entrust Full time

    Career Growth, Flexibility and Collaboration! Entrust is dedicated to keeping the world moving safely by enabling trusted identities, payments, and data protection around the globe. Headquartered in Minnesota, we offer our colleagues the ability to work globally, in a flexible and collaborative environment. Our team makes an impact!! The Company: Entrust...


  • Salt Lake City, United States bioMérieux SA Full time

    Description Position Summary: Business Analyst Interns partner with software teams to research, plan, test, and maintain critical solutions for various software applications. This will require you to provide high quality customer service to internal parties and develop strong relationships with partners inside the business. You will support technical teams...


  • Salt Lake City, United States BIOMERIEUX, INC. Full time

    Description Position Summary: Business Analyst Interns partner with software teams to research, plan, test, and maintain critical solutions for various software applications. This will require you to provide high quality customer service to internal parties and develop strong relationships with partners inside the business. You will support technical teams...


  • Salt Lake City, United States BioFire Diagnostics Full time

    Position Summary: Business Analyst Interns partner with software teams to research, plan, test, and maintain critical solutions for various software applications. This will require you to provide high quality customer service to internal parties and develop strong relationships with partners inside the business. You will support technical teams with an...


  • Lake Mary, United States Tews Company Full time

    Job DescriptionJob DescriptionTEWS is looking for a Sr. Business Analyst for a growing private equity backed organization based in central Florida. This is a full-time, permanent role with an established, growing company with a great work environment and reputation. Qualified applicants will have:Extensive Business Analysis experience (gathering...

  • Sr. Business Analyst

    2 weeks ago


    Lake Mary, United States Tews Company Full time

    Job DescriptionJob DescriptionTEWS is looking for a Sr. Business Analyst for a growing private equity backed organization based in central Florida. This is a full-time, permanent role with an established, growing company with a great work environment and reputation. Qualified applicants will have:Extensive Business Analysis experience (gathering...


  • Lake City, United States CareerBuilder Full time

    Dice is the leading career destination for tech experts at every stage of their careers. Our client, Talent Group, is seeking the following. Apply via Dice today! Need only Locals to FL Job Role: Business Analyst for Health Management industry. Location: Lake City, FL ( Need only Locals to FL) (Onsite or Hybrid or Remote): Can be hybrid or remote....

  • Business Analyst

    3 weeks ago


    Salt Lake City, United States knightsbridgesolutions Full time

    How To Apply : Please send an email to [ hr@jobsai.live ] with the subject "Application" and your resume in order to receive the steps to continue the process. Thank you.DescriptionWe are seeking a highly skilled and detail-oriented Business Analyst to join our team on a one-year contract basis. As a Business Analyst, you will play a crucial role in...

  • Business Analyst

    2 weeks ago


    Minneapolis, Minnesota, United States SPS COMMERCE Full time

    Description: SPS Commerce has an immediate opening for a Business Analyst who will be primarily focused on the creation of documentation . The successful candidate will be responsible for internal documentation aimed at enhancing operational efficiency and facilitating knowledge transfer within the organization. The core function will be producing...