Current jobs related to Medical Assistant - Thousand Oaks - Gameday Men's Health
-
Medical Assistant
4 weeks ago
Thousand Oaks, California, United States Forefront Dermatology Full timeMedical Assistant Job DescriptionWe are seeking a highly skilled and detail-oriented Medical Assistant to join our team at Forefront Dermatology. As a Medical Assistant, you will play a vital role in providing exceptional patient care and supporting our dermatologists in their daily activities.Key Responsibilities:Room patients and document vital...
-
Medical Assistant
1 month ago
Thousand Oaks, United States Forefront Dermatology Full time $21 - $25Come join our team! We have an immediate need for a Medical Assistant in our Thousand Oaks, CA clinic! If you are ready to make an impact every day, and thrive in a fast-paced environment, then a career at Forefront may be the perfect fit for you! Summary:The Medical Assistant is essential during the patient visit, accompanying the dermatologist in the room...
-
Medical Assistant
4 weeks ago
Thousand Oaks, United States Actalent Full timeJob DescriptionJob DescriptionFertility clinic is looking for a full time medical assistant with at least 1 year of experience to work in Thousand Oaks and Encino. Both locations are fast paced clinics where medical assistants will be performing 20-30 blood draws per day.WHAT'S IN IT FOR YOU:Clinic is expanding - this is a long-term position on a team...
-
Medical Assistant
2 weeks ago
Thousand Oaks, United States Actalent Full timeJob DescriptionJob DescriptionWell-Renowned Women's Health and Fertility clinic is looking for a full time medical assistant with at least 1 year of experience to work in Thousand Oaks and Encino. Both locations are fast paced clinics where medical assistants will be performing 20-30 blood draws per day.WHAT'S IN IT FOR YOU:Clinic is expanding -...
-
Medical Assistant Position
4 weeks ago
Thousand Oaks, California, United States Exer Urgent Care Full timeJob SummaryWe are seeking a highly skilled and compassionate Medical Assistant to join our team at Exer Urgent Care. As a Medical Assistant, you will play a vital role in providing exceptional patient care and supporting our healthcare team.Key ResponsibilitiesAssist physicians with examination and treatment of patients, ensuring a smooth and efficient...
-
Medical Assistant Position
4 weeks ago
Thousand Oaks, California, United States Exer Urgent Care Full timeJob SummaryWe are seeking a highly skilled and dedicated Medical Assistant to join our team at Exer Urgent Care. As a Medical Assistant, you will play a vital role in providing exceptional patient care and supporting our healthcare team.Key ResponsibilitiesInterview patients, measure vital signs, and record information on patients' charts.Prepare treatment...
-
Medical Office Assistant
2 weeks ago
Thousand Oaks, California, United States Tryfacta Full timeJob OpportunityAbout Tryfacta: We are a leading Workforce Management Solution provider for private and public sector firms across the US, specializing in Healthcare, IT, Business Support, and Professional & Craft/Light Industrial ecosystems.Founded in 1996, we have a presence in all 50 States and have been recognized as one of the fastest-growing companies...
-
Medical Assistant
1 week ago
Thousand Oaks, California, United States US Derm Support Roles Full timeJob Title: Medical Assistant - Dermatology SpecialistOverviewThe ideal candidate will be able to work as a Medical Assistant with both Mohs and General Dermatology. We are seeking a highly skilled and detail-oriented Medical Assistant to join our Mohs Surgery team.Responsibilities:Assist the Mohs surgeon during procedures according to prescribed...
-
Medical Assistant Professional
7 days ago
Thousand Oaks, California, United States Ventura Orthopaedic Medical Group Full timeh3JobSummary/h3pVenturaOrthopaedicMedicalGroupisseekingahighlyskilledMedicalAssistanttosupportourhealthcareprovidersindeliveringexceptionalpatientcare./ppTheidealcandidatewillpossessexcellentcommunicationandorganizationalskills,withtheabilitytoworkeffectivelyinafast-pacedenvironment./ppbKeyResponsibilities:/b/pulliAssisthealthcareproviderswithclinicalandadmi...
-
Medical Assistant
3 weeks ago
Thousand Oaks, United States Platinum Dermatology Partners Full time*Medical Assistant – Conejo Dermatology*Platinum Dermatology Partners – *Thousand Oaks, CA**Who We Are:*Platinum Dermatology Partners is a network of high-quality dermatology clinics that focus on collaborative and innovative ideas to drive growth. We offer general dermatology, cosmetic, medical, plastic surgery, and cancer screening treatments. We have...
-
Medical Assistant
6 days ago
Thousand Oaks, California, United States Forefront Dermatology Full timeMedical Assistant - Dermatology SpecialistWe are seeking a highly skilled Medical Assistant to join our team at Forefront Dermatology. As a Medical Assistant, you will play a vital role in providing exceptional patient care and supporting our dermatologists in their daily tasks.Key Responsibilities:Room patients and document vital informationScribe...
-
Medical Assistant Back Office
1 month ago
Thousand Oaks, United States Actalent Full timeJob DescriptionJob DescriptionMedical Assistant - Back OfficeFertility and surgical clinic in Thousand Oaks and Encino is looking for a medical assistant to join their team! Medical Assisting diploma is required. This is an opportunity to work in a fast-paced environment and gain extensive back office experience! What's in it for you?Join an amazing...
-
Medical Territory Representative
1 day ago
Thousand Oaks, California, United States Inspire Medical Systems Full timeAbout Inspire Medical SystemsInspire Medical Systems is a pioneering company in the medical device industry, dedicated to revolutionizing the treatment of Obstructive Sleep Apnea (OSA). Our FDA-approved medical device, Inspire, is designed to reduce OSA severity for those who cannot tolerate or get consistent benefit from CPAP.We are committed to enhancing...
-
Medical Assistant
1 week ago
Thousand Oaks, California, United States UCLA Health Full timeJob Summary:In this role, you will provide patient care in the ambulatory setting, recognizing normal and abnormal signs and symptoms, and providing support during life-threatening emergencies. You will also perform basic administrative, clerical, and technical supportive services as needed.Responsibilities:Provide patient care in the ambulatory setting,...
-
X-Ray Technician/Medical Assistant
2 weeks ago
Thousand Oaks, California, United States Ventura Orthopedics Full timeJob SummaryWe are seeking a highly skilled and detail-oriented X-Ray Technician/Medical Assistant to join our team at Ventura Orthopedics. As a key member of our medical staff, you will be responsible for performing x-rays, assisting with patient examinations, and providing exceptional customer service.Key ResponsibilitiesPerform x-ray examinations and...
-
Medical Staff Coordinator
1 week ago
Thousand Oaks, California, United States Los Robles Regional Medical Center Full timeJob SummaryWe are seeking a highly skilled and organized Credentials Coordinator to join our team at Los Robles Regional Medical Center. The successful candidate will be responsible for coordinating and overseeing the Medical Staff Services Department, ensuring seamless communication and workflow between medical staff committees, the Medical Executive...
-
Medical Assistant
1 week ago
Thousand Oaks, California, United States Actalent Full timeJob Title: Medical AssistantWe are seeking a highly skilled and experienced Medical Assistant to join our team at a well-renowned Women's Health and Fertility clinic in Thousand Oaks and Encino.Job Summary:The Medical Assistant will assist in the examination and treatment of patients, performing delegated duties under the direction of a physician. The ideal...
-
Medical Staff Coordinator
2 weeks ago
Thousand Oaks, California, United States Los Robles Regional Medical Center Full timeJob SummaryWe are seeking a highly skilled and detail-oriented Credentials Coordinator to join our team at Los Robles Regional Medical Center. As a key member of our Medical Staff Services Department, you will be responsible for coordinating and overseeing various aspects of medical staff operations, including meeting management, information flow, and...
-
Medical Scribe Assistant
6 days ago
Thousand Oaks, California, United States Ventura Orthopedics Full timeJob SummaryAt Ventura Orthopedics, we are seeking a detail-oriented and organized Medical Scribe to provide vital support to our medical professionals. This role involves transcribing medical data quickly and accurately while patients are being examined, preparing electronic charts, and maintaining records using accurate spelling, correct grammar, and...
-
Medication Safety Pharmacist
4 weeks ago
Thousand Oaks, United States Los Robles Regional Medical Center Full timeDescription Hourly Wage Estimate: $70.10 - $91.14 / hour Learn more about the benefits offered for this job. The estimate displayed represents the typical wage range of candidates hired. Factors that may be used to determine your actual salary may include your specific skills, how many years of experience you have and comparison to other employees already...
Medical Assistant
3 months ago
GameDay Men's Health is hiring a Medical Assistant for its Thousand Oaks, CA location. The position is ideal for someone interested in being a part of a pioneering health program for men. (www.gamedaymenshealth.com/thousand-oaks).
GameDay was created for one simple reason: To give men a world-class experience while overcoming low testosterone so they can reclaim their life. Set in a man-cave environment - plush with flat screen TV's, comfortable chairs, hardwood floors, and sports memorabilia - GameDay is revolutionizing the way men get effective treatment. We have hundreds of patients who receive testosterone replacement therapy and other men's services throughout our many locations. Are you passionate about patient care? If so, we'd like to meet you
The Medical Assistant will be responsible for:
- Phlebotomy (blood draws) of patients
- Injections (Testosterone, Gonadorelin, B12 and other vitamins)
- Checking patient vitals and recording in EMR
- Ensuring all lab results are input into patient charts
- Assisting medical providers with patient care
- Greeting patients
- Assisting in lab operations
- Maintaining accurate records in EMR and adhering to all HIPAA Protocols.
- Scheduling appointments
-Opportunity to assist with social media engagement
Qualifications: Experience in a related field, such as medspas, urology, family practice, lab, endocrinology, gynecology or general practice is preferred. No current or pending malpractice lawsuits
Resume Required? Yes
Key Qualifications: Medical Assistant Certification is Required
Job Types: Full-time, Part-time
Pay: $21.00 - $24.00 per hour
Expected hours: 24 – 40 per week
Benefits:
- 401(k)
- Free parking
- Health insurance
- On-the-job training
- Paid training
- Travel reimbursement
Medical Specialty:
- Endocrinology
- Primary Care
- Sports Medicine
- Urology
Schedule:
- 8 hour shift
- Day shift
- Monday to Friday
- No nights
- No weekends
Education:
- High school or equivalent (Required)
Experience:
- EMR systems: 1 year (Required)
- Vital signs: 1 year (Required)
- Phlebotomy: 1 year (Preferred)
License/Certification:
- BLS Certification (Required)
- Certified Medical Assistant (Required)
Ability to Commute:
- Thousand Oaks, CA 91361 (Required)
Ability to Relocate:
- Thousand Oaks, CA 91361: Relocate before starting work (Required)
Work Location: In person
Company DescriptionGameday prides itself on integrity and patient safety. Accordingly, Gameday only treats men with a verifiable testosterone deficiency (hypogonadism) as evidenced by comprehensive labwork, presenting symptomology, and a complete medical evaluation by our licensed provider(s). Gameday also offers treatment for erectile disfunction (ED), weight loss, vitamin and peptide therapy.Company DescriptionGameday prides itself on integrity and patient safety. Accordingly, Gameday only treats men with a verifiable testosterone deficiency (hypogonadism) as evidenced by comprehensive labwork, presenting symptomology, and a complete medical evaluation by our licensed provider(s). Gameday also offers treatment for erectile disfunction (ED), weight loss, vitamin and peptide therapy.