Loss Prevention Officer

4 weeks ago


Tampa, United States Marriott International, Inc Full time
Additional Information Part-Time, Evening Shifts, Weekends, Holidays availability required
Job Number 24181955
Job Category Loss Prevention & Security
Location The Tampa EDITION, 500 Channelside Drive, Tampa, Florida, United States VIEW ON MAP
Schedule Part-Time
Located Remotely? N
Relocation? N
Position Type Non-Management

POSITION SUMMARY

Patrol all areas of the property; assist guests with room access. Monitor Closed Circuit Televisions, perimeter alarm system, duress alarms, and fire life safety system. Lock property entrances when required. Conduct daily physical hazard inspections. Respond to accidents, contact EMS or administer first aid/CPR as required. Assist guests/employees during emergency situations. Notify appropriate individuals in the event of accidents, attacks, or other incidents. Defuse guest/employee disturbances. Call for outside assistance if necessary. Complete incident reports to document all Security/Loss Prevention related incidents. Handle all interruptions and complaints. Resolve safety hazard situations. Escort any unwelcome persons from the property without interrupting the orderly flow of property operation. Report to scenes of vehicle accidents/thefts. Call for assistance using proper code responses. Complete a Loss Prevention shift summary/daily activity report. Maintain confidentiality of all Security/Loss Prevention and property reports/documents; release information only to authorized individuals. Conduct investigations and gather evidence. Conduct interviews with relevant parties.

Follow all company policies and procedures; report accidents, injuries, and unsafe work conditions to manager; complete safety training and certifications; ensure uniform and personal appearance are clean and professional; maintain confidentiality of proprietary information; protect company assets. Welcome and acknowledge all guests according to company standards; anticipate and address guests’ service needs; assist individuals with disabilities; thank guests with genuine appreciation. Speak with others using clear and professional language; prepare and review written documents accurately and completely. Develop and maintain positive working relationships with others; support team to reach common goals. Comply with quality assurance expectations and standards. Stand, sit, or walk for an extended period of time. In addition, some states may have additional licensing/registration requirements to be considered for this position. Read and visually verify information in a variety of formats (e.g., small print). Visually inspect tools, equipment, or machines (e.g., to identify defects). Enter and locate work-related information using computers and/or point of sale systems. Move at a speed required to respond to work situations (e.g., run, walk, jog). Stand, sit, or walk for an extended period of time or for an entire work shift. Move, lift, carry, push, pull, and place objects weighing less than or equal to 50 pounds without assistance and objects weighing in excess of 75 pounds with assistance. Grasp, turn, and manipulate objects of varying size and weight, requiring fine motor skills and hand-eye coordination. Move through narrow, confined, or elevated spaces. Move over sloping, uneven, or slippery surfaces as well as up and down stairs and/or service ramps. Reach overhead and below the knees, including bending, twisting, pulling, and stooping. Perform other reasonable job duties as requested by Supervisors.

PREFERRED QUALIFICATIONS

Education: High school diploma or G.E.D. equivalent.

Related Work Experience: No related work experience.

Supervisory Experience: No supervisory experience.

License or Certification: None

Marriott International is an equal opportunity employer. We believe in hiring a diverse workforce and sustaining an inclusive, people-first culture. We are committed to non-discrimination on any protected basis, such as disability and veteran status, or any other basis covered under applicable law.

EDITION Hotels combine the visionary genius of boutique hotelier Ian Schrager, the service delivery of a world-class luxury hotel, and the global reach of Marriott International to create an entirely new experience in the world of hospitality. EDITION delivers the best of both worlds in a delicate balancing act – polish with personality, perfectionism with individualism, and comfort with charisma and charm. The brand targets sophisticated, knowledgeable consumers who understand quality, originality, design, and service excellence, but who want it without limitations – breaking the bounds of convention and demanding an attitude and a feeling wrapped in a package that showcases the exceptional.
But to create this magical experience, we need you. We are looking for outgoing, authentically amazing people who are looking for a place to work that inspires them, challenges them and makes them proud to come to work. A place where service comes from the heart, not from a handbook. A place that delivers a never-ending theatrical performance that continuously delights and enchants each and every one of our guests.
We invite you to join us today. In joining EDITION, you join a portfolio of brands with Marriott International. Be where you can do your best work,​ begin your purpose, belong to an amazing global​ team, and become the best version of you.


  • Tampa, Florida, United States Metro One Loss Prevention Services Group Full time

    **Job Summary**At Metro One Loss Prevention Services Group, we are seeking a dedicated and reliable Part Time Unarmed Security Officer to join our team. As a Security Officer, you will be responsible for providing excellent customer service, watching CCTV camera systems, and notating accurately in daily activity reports.**Key Responsibilities:**Provide...


  • Tampa, United States Marriott International, Inc Full time

    Additional Information Part-Time, Evening Shifts, Weekends, Holidays availability requiredJob Number 24181955Job Category Loss Prevention & SecurityLocation The Tampa EDITION, 500 Channelside Drive, Tampa, Florida, United States VIEW ON MAPSchedule Part-TimeLocated Remotely? NRelocation? NPosition Type Non-Management POSITION SUMMARY Patrol all areas of the...


  • Tampa, United States MSCCN Full time

    Additional Information Evening Shift, Weekend Availability, Holiday Availability Job Number 24173152 Job Category Loss Prevention & Security Location The Tampa EDITION, 500 Channelside Drive, Tampa, Florida, United States, 33602VIEW ON MAP (Tampa EDITION, 500 Channelside Drive, Tampa, Florida, United States, 33602) Schedule Full Time Located Remotely? N...


  • Tampa, United States Marriott International, Inc Full time

    Additional Information Part-Time, Evening Shifts, Weekends, Holidays availability requiredJob Number 24181955Job Category Loss Prevention & SecurityLocation The Tampa EDITION, 500 Channelside Drive, Tampa, Florida, United States VIEW ON MAPSchedule Part-TimeLocated Remotely? NRelocation? NPosition Type Non-Management POSITION SUMMARY Patrol all areas of the...


  • Tampa, United States Marriott International Inc Full time

    Additional InformationResidences, Overnight Shift, Day Shift, Evening Shift, swing shift Job Number24179663 Job CategoryLoss Prevention & Security LocationThe Ritz-Carlton Residences Tampa, 505 Water Street, Tampa, Florida, United States, 33602VIEW ON MAP ScheduleFull Time Located Remotely?N Position Type Non-Management POSITION SUMMARY Patrol all areas of...


  • Tampa, United States Marriott International, Inc Full time

    Additional InformationFulltime, Evening Shifts, Weekends and holidays availabilityJob Number24194254Job CategoryLoss Prevention & SecurityLocationThe Tampa EDITION, 500 Channelside Drive, Tampa, Florida, United States, 33602VIEW ON MAPScheduleFull TimeLocated Remotely?NPosition Type Non-Management POSITION SUMMARY   Patrol all areas of the property; assist...


  • Tampa, United States Marriott International, Inc Full time

    Job DescriptionAdditional Information Part-Time, Evening Shifts, Weekends, Holidays availability requiredJob Number 24181955Job Category Loss Prevention & SecurityLocation The Tampa EDITION, 500 Channelside Drive, Tampa, Florida, United States VIEW ON MAPSchedule Part-TimeLocated Remotely? NRelocation? NPosition Type Non-ManagementPOSITION SUMMARYPatrol all...


  • Tampa, Florida, United States Marriott International Inc Full time

    Job SummaryAs a Loss Prevention Officer at Marriott International Inc, you will be responsible for ensuring the safety and security of our guests and employees. This role requires a high level of attention to detail, excellent communication skills, and the ability to work effectively in a fast-paced environment.Key ResponsibilitiesPatrol all areas of the...


  • Tampa, Florida, 33602, Hillsborough County, FL, United States Marriott International, Inc Full time

    Additional InformationFull-Time, Evening Shifts, Weekends Availability, Holiday AvailabilityJob Number24194254Job CategoryLoss Prevention & SecurityLocationThe Tampa EDITION, 500 Channelside Drive, Tampa, Florida, United States, 33602VIEW ON MAPScheduleFull TimeLocated Remotely?NPosition Type Non-Management POSITION SUMMARY Patrol all areas of the...


  • Tampa, United States GameStop Full time

    GameStop - (Undisclosed Location) Tampa [Asset Protection / Security] As a Loss Prevention Agent at GameStop, you'll: Monitor and protect Distribution/Refurb property, assets, customers and employees; Reduce DC/Refurb losses created by external and internal theft; Conduct security patrols in specified areas; Prevent loss of or damage to merchandise/building...


  • Tampa, Florida, United States Metro One The Loss Prevention Group, Inc. Full time

    Unlock Your Potential in a Rewarding CareerAre you passionate about delivering exceptional service? Do you want to find a balance between work and life? Metro One Loss Prevention Service Group offers a unique opportunity for you to grow in a true valued profession.As a Part Time Unarmed Security Officer, you will be part of a team that values work-life...

  • Security Specialist

    4 weeks ago


    Tampa, Florida, United States Metro One Loss Prevention Services Group Full time

    We are seeking a dedicated and detail-oriented Security Specialist to join our team at Metro One Loss Prevention Services Group. As a Security Specialist, you will be responsible for observing and surveying activity at your assigned location, providing accurate reporting, and ensuring the safety and security of our clients.Key responsibilities...

  • Security Specialist

    3 weeks ago


    Tampa, Florida, United States Metro One Loss Prevention Services Group Full time

    At Metro One Loss Prevention Services Group, we're seeking a dedicated individual to join our team as a Security Professional. As a key member of our team, you'll be responsible for observing, surveying, and reporting on activity at your assigned location. This role requires a passion for service and a commitment to delivering exceptional results.Key...


  • Tampa, Florida, United States Creighton Health Care Inc Full time

    Job RoleAs a Medical Office Assistant in our Weight Loss Office, you will be responsible for providing exceptional patient care and support in a fast-paced environment.Key ResponsibilitiesConduct blood draws and administer injections as neededReview and assist with diet plans for patientsSchedule patient appointments and manage office workflowAnswer phone...

  • Security Officer

    4 weeks ago


    Tampa, Florida, United States Marriott Full time

    Job SummaryWe are seeking a highly skilled and experienced Security Officer to join our team at The Tampa EDITION. As a key member of our Loss Prevention and Security team, you will be responsible for ensuring the safety and security of our guests and employees.Key ResponsibilitiesPatrol all areas of the property to prevent and detect potential security...


  • Tampa, Florida, United States Creighton Health Care Inc Full time

    Job OverviewWe are seeking a highly skilled Medical Assistant to join our team at Creighton Health Care Inc.The ideal candidate will have experience in a medical office setting and be proficient in performing blood draws, administering injections, and reviewing diet plans.Responsibilities include scheduling patients, answering phones, and providing...


  • Tampa, Florida, United States Creighton Health Care Inc Full time

    Job DescriptionWe are seeking a highly skilled Medical Assistant/LPN to join our team at Creighton Health Care Inc. The ideal candidate will have experience in blood draws, administering injections, and reviewing diet plans.Key Responsibilities:Perform blood draws and administer injections as neededReview and provide feedback on patient diet plansSchedule...


  • Tampa, Florida, United States Marriott International Inc Full time

    bJobSummary/bbrbrAsaLossPreventionSpecialistatMarriottInternationalInc,youwillberesponsibleforensuringthesafetyandsecurityofourguestsandemployees.Thisrolerequiresahighlevelofattentiontodetail,excellentcommunicationskills,andtheabilitytoworkeffectivelyinafast-pacedenvironment.brbrbKeyResponsibilities/bbrulliPatrolallareasofthepropertytopreventanddetectpotenti...


  • Tampa, Florida, United States Arthur J Gallagher & Co. Full time

    Job SummaryGallagher Bassett Technical Services (GBTS) division is seeking a Construction Safety Loss Control Consultant to perform safety/loss control risk inspection on multi-year construction projects located in the educational/university business sector.Key ResponsibilitiesConducts multi-line and/or specialty loss and operational analysis to achieve...


  • Tampa, United States Titan Medical Center Full time

    Job DescriptionJob DescriptionSeeking an APRN/ Nurse Practitioner for our growing Wellness and Anti Aging Clinic. This position will be a full-time position due to the growth of the clinic. Our clinic specializes in hormone replacement therapies, medical weight loss, vitamin/ amino acid therapies, bloodwork, peptides, aesthetics, IV therapy and anti aging....