HVAC Technician

Job SummaryWe are seeking a highly skilled Non-Licensed HVAC Technician to join our team at Novant Health. As a key member of our Plant Engineering Services department, you will be responsible for maintaining the service life of company assets, including physical structures, HVAC, mechanical, utilities, and grounds.ResponsibilitiesPerform advanced level...

Job OverviewWe are seeking a highly skilled Commercial HVAC Service Manager to join our team at The Blue Collar Recruiter of Philadelphia. This is a senior leadership role that requires strong management experience and a proven track record of success in the commercial HVAC industry.Key ResponsibilitiesManage and supervise a team of service department...

About the RoleWe are seeking a skilled Maintenance Technician to join our team at Brookdale Senior Living. As a Maintenance Technician, you will play a critical role in ensuring the comfort and safety of our residents by performing routine maintenance and repairs on community buildings and grounds.ResponsibilitiesMaintain scheduled and unscheduled...

Job SummaryWe are seeking a skilled Maintenance Technician II to join our team at Forsyth County, NC. As a key member of our facilities maintenance team, you will be responsible for maintaining a variety of plumbing systems throughout our facilities.Key ResponsibilitiesPerform routine maintenance and repairs on plumbing systems, including inspections,...

Job SummaryAs a Maintenance Worker at McDonald's, you will be responsible for ensuring the cleanliness and functionality of our facilities. This includes daily tasks such as cleaning equipment, unloading delivery trucks, and taking out the trash.Key ResponsibilitiesFilter oil fryers dailyClean equipment, inside and outside windows, stock rooms, and...

Maintenance Worker Job DescriptionAs a Maintenance Worker at McDonald's, you will be responsible for ensuring the cleanliness and functionality of our facilities. Your duties will include:Key Responsibilities:Filtering oil fryers daily to maintain a safe and healthy environmentCleaning equipment, windows, stock rooms, and restrooms to maintain a clean and...

McDonald's Maintenance Worker Job SummaryWe are seeking a skilled Maintenance Worker to join our team at McDonald's. As a key member of our facilities team, you will be responsible for ensuring the cleanliness and maintenance of our restaurant equipment and facilities.Key Responsibilities:Filter oil fryers daily to maintain optimal performance and...

h3JobOverview/h3pComfortFirstHeating&CoolingisseekingaskilledHVACServiceTechniciantorepresentourcompanywhileprovidingexceptionalservicetoourclients.Theidealcandidatewillhaveastrongbackgroundinheatingandcoolingsystems,excellentcustomerserviceskills,andtheabilitytoworkindependentlyinafast-pacedenvironment./ppWeofferacompetitivesalaryrangeof$50,000-$100,000,dep...

Job SummaryCMS Controls is seeking a skilled DDC Controls Systems Specialist to join our team. As a Commissioning and Startup Technician, you will be responsible for testing and documenting control points, ensuring hardware and software meet sequence of operations, and verifying systems function properly.Key ResponsibilitiesProgramming, commissioning, and...

Job Title: Mechanical General ForemanOverview:The Mechanical General Foreman plays a pivotal role in overseeing all mechanical construction activities on a project site. Responsible for managing a team of skilled tradespeople, this position ensures that mechanical systems are installed, maintained, and repaired efficiently and in accordance with project...

Title: HVAC Technician - up to $40/hr. base pay $3000 Sign-on BonusHVAC Technician - Are you an HVAC Service expert who is passionate about problem solving and customer service? Looking to accelerate your career (and income!) with an organization who values its people? Come see why so many of our team members and customers recommend Horizon!Our HVAC Service...

Overview:$10,000 Signing BonusAbout F.H. Furr:A major player in residential home services for over 42 yearsServing Southern Delaware from our Georgetown officeWhy Choose F.H. Furr:Competitive performance-based compensationTop-notch residential HVAC environmentDedicated support teamLong-term job stabilityOpportunities for advancementInnovative and...

Position Details: --- Title: HVAC Service Technician III or IV --- Location: Georgetown, DE --- Shift: 8 am to 5pm. Weekends for on call representative; rotating. --- Compensation: Commissioned based Salary, but with built in clients with guaranteed service times; will not need to build client base. Minimum $25-50 per client stop; roughly 4 stops per...

Job SummaryThe HVAC Technician 2 role at Sunbelt Rentals is a key position that requires a high level of professionalism and excellent communication skills. This individual will be responsible for delivering and installing rented HVAC equipment, training customers on its safe use, and troubleshooting any issues that may arise.Key Responsibilities:Deliver and...

About IdealAir Heating & CoolingWe are a dedicated force in addressing the HVAC needs of homes and businesses. Our headquarters boasts a cutting-edge 14,000-square-foot fabrication shop and office facility, serving as the nucleus of our operations.Our CultureWe foster a collaborative environment where every team member plays a vital role in delivering...

Job OverviewPuskar Heating & Air Conditioning is seeking a skilled HVAC technician to install and maintain heating and cooling systems in residential and commercial settings. As a member of our team, you will have the opportunity to work on a variety of projects, from new construction to existing building renovations.We offer a competitive salary and...

Del-Air Heating, Air Conditioning, Electrical, and Plumbing Job DescriptionWe are seeking a skilled HVAC Technician to join our team at Del-Air Heating, Air Conditioning, Electrical, and Plumbing. As a leading residential HVAC company in Central Florida, we offer a dynamic work environment and opportunities for career growth and advancement.Job SummaryThe...

Job SummaryTradesmen International is seeking a skilled HVAC Technician to join our team. As an HVAC Tech, you will be responsible for installing, servicing, and repairing air conditioning, refrigeration, and heating units.Key ResponsibilitiesAssemble, install, and service HVAC equipmentDiagnose and repair equipment breakdownsStudy building plans and working...

Job SummaryWe are seeking a skilled HVAC Service Technician to join our team at Bobs Quality Heating and Cooling. The ideal candidate will have a strong background in heating, ventilation, and air conditioning systems, with the ability to diagnose and repair complex issues.Responsibilities:Service and inspect heating, ventilation, and air conditioning...

Tradesmen International - JobID: DCC6D143E35445C8810DA340BD6EA96E [Installation] As an HVAC Tech at Tradesmen International, you'll: Be responsible for assembling, installing, servicing, and repairing air conditioning, refrigeration, and heating units; Study building plans and working drawings to determine work aids required and sequence of installations;...

Tradesmen International - JobID: 20BF1A4FAA004FC78231A8894D31FC00 [Installation] As an HVAC Tech at Tradesmen International, you'll: Be responsible for assembling, installing, servicing, and repairing air conditioning, refrigeration, and heating units; Study building plans and working drawings to determine work aids required and sequence of installations;...

HVAC Technician Job SummaryWe are seeking a skilled HVAC Technician to join our team at Horizon Services. As an HVAC Service Expert, you will be responsible for troubleshooting, diagnosing, and repairing residential heating and cooling systems. Our technicians have the opportunity to earn up to $48+/hr. with bonuses and incentives.What We OfferCompetitive...

Country: United States of AmericaLocation: CAD04: CRS-Bear 500 Carson Drive, Bear, DE, 19701 USA Carrier is the leading global provider of healthy, safe, and sustainable building and cold chain solutions with a world-class, diverse workforce with business segments covering HVAC, refrigeration, and fire and security. We make modern life possible by delivering...

Job DescriptionAt Sunbelt Rentals, we are seeking a highly skilled HVAC Technician 2 to join our team. As a key member of our team, you will be responsible for delivering and installing rented HVAC equipment, training customers on safe use, and troubleshooting equipment issues.Key Responsibilities:Communicate professionally with customers, managers, and...

Job DescriptionWe are seeking a skilled HVAC Installation Team Lead to oversee the installation of HVAC systems in residential and commercial settings.This role requires strong leadership and technical skills to manage a team of HVAC installation technicians and ensure timely completion of projects.Key Responsibilities:Lead a team of HVAC installation...

Job TitleHVAC Building Maintenance TechnicianJob Description SummaryThe Maintenance Technician is responsible for delivering exceptional service and support to our clients, ensuring seamless operations and maintaining a high level of customer satisfaction.This role requires working alternating Saturdays, and the successful candidate will be able to adapt to...

Job Summary:Durr Megtec Durr Universal, Inc. is seeking a skilled Industrial Equipment Technician to join our team. As a Field Service Representative, you will travel extensively to commission, maintain, and repair industrial dryers, regenerative thermal oxidizers (RTO), electrostatic precipitators (ESP), and related equipment. This position requires strong...

Commercial Building Maintenance TechnicianWe are seeking an experienced Commercial Building Maintenance Technician to join our team at The High Companies. As a key member of our maintenance team, you will be responsible for ensuring the smooth operation of our commercial properties.Key Responsibilities:Perform routine maintenance tasks, including HVAC,...

Job OverviewParamark Corp is seeking a highly skilled Property Manager/Maintenance Technician to join our team. As a hybrid position, you will be responsible for managing all aspects of assigned properties, maintaining a positive relationship with tenants, and performing maintenance tasks.Key Responsibilities:Manage properties' personnel and assess its...

Job SummaryThe General Maintenance Technician II is a skilled professional responsible for performing maintenance services and repairs in various areas, including plumbing, drywall, texture, tile, carpentry, painting, electrical, cabinetry, laminates, and appliance servicing. This role requires a minimum of two years of experience in the relevant fields and...